The longest town name and longest railway station name in britain is that of a welsh town named llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch. A channel 4 news weatherman pronounces the longest place name in wales, llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch and he does it perfectly. Apr 06, 2008 krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit in thailand has 163 letters and is the worlds longest place name. Weatherman easily pronounced 58letter welsh town name. A weatherman pronounced a 58letter word during a live broadcast like it was nothing. Dec 15, 2018 the little welsh town thats home to britains best high street. Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch llanfair pg for short is a small, quiet town on the island of anglesey off the northwest coast of north wales, famous for having the longest place name in an englishspeaking country. This 19syllable jawbreaker is the longest placename in europe, and the longest oneword name of any municipality in. Marys church in the hollow of white hazel near a rapid whirlpool and the. Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch. But while it is the longest tonguetwisting welsh place name. Many single welsh women and men in wales are looking for romance and more at this dating in wales site. May 14, 2017 wondering how to say the longest town name in the world. Bangkoks full name is a 167letter tongue twister, but its.
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch atlas. The longest municipality name in the czech republic is the name of nova ves u noveho mesta na morave 33 characters, english translation. Mary in the hollow of white hazel trees near the rapid whirlpool by st. Welsh town harlech has claimed the record title for the worlds steepest street with the winding street of ffordd pen llech.
Welsh villages 58letter name is the longest word on any map in europe lauren oneil cbc news posted. Feb 11, 2016 welsh places with brilliantly long names. Sep 09, 2015 it got pretty warm in the welsh town of llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch yesterday, and channel 4 weatherman liam dutton didnt blink when. British weatherman liam dutton nailed an incredibly long. It may be a mouthful to say, but llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch in north west wales was one of the warmest. Saint marys church in the hollow of the white hazel near a rapid whirlpool and the church of st. To help you to understand how we get the translation above, here is a breakdown of the name and a translation of some welsh words.
Watch naomi watts pronounce name of waless longest town perfectly. He nailed europes longest place name live on tv and now weatherman liam dutton has a new favourite sounding welsh word wales online. The story behind the welsh town has the longest name in. It may be a mouthful to say, but llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch in north west wales was one of the warmest places in the uk today.
The longest place name in the world is this town in new zealand. Weatherman slays longest welsh town name mental floss. Railway station with the longest name, 58 characters. The long form of the name is the longest place name in the united kingdom and one of the longest in the world at 58 characters 51 letters since ch and ll are digraphs, and are treated as single letters in the welsh language. Llanfair pwllgwyngyll is a village on the island of anglesey in wales, britain.
Noting that it was unseasonably hot in the area, he elected. Llanfairpwllgwyngyllgogerychwyrndrobwyllllantysiliogogogoch. Here are 25 bizarrely named pennsylvania towns that will leave you scratching your head. Listed in the guinness book of records 2002 included in the new anglesey monopoly game see article on the bbc website anglesey is also the home of the duke and duchess of cambridge prince william heir to the british throne. Llanfairpwllgwyngyllgogerychwyrndrobwyllllantysiliogogogoch is just.
Wales is a country in europe, part of the united kingdom. Sep 09, 2015 a channel 4 news weatherman pronounces the longest place name in wales, llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch and he does it perfectly. It is in the guinness book of records for being the place with the longest name in britain. Weatherman pronounces llanfairpwllgwyngyllgogerychwyrndrob. New village in near of new town in moravia, the second one is the city of brandys nad labemstara boleslav 32 characters, english translation. Longest human tunnel travelled through by a skateboarding dog. Apart from its name it is similar to other nearby villages. At 58 letters, llanfairpwllgwyngyllgogerychwyrndrobwyllllantysiliogogogoch is the longest town name in all of europe.
A village in anglesey in north wales, known for having the longest place name in the united kingdom. The undisputable longest valid domain name in the world also links to this website. Heres the story behind the 58letter town name in wales. Jan 10, 2012 this 19syllable jawbreaker is the longest placename in europe, and the longest oneword name of any municipality in the world. Thailand has beaten challenges from new zealand and wales for the worlds longest place name. If you ask nicely, the lady at the tourist information office will pronounce the name of her town.
The village has the longest place name in europe and one of the longest place names in the world. The name was coined as a publicity gimmick in the 1860s by concatenating the names of llanfairpwllgwyngyll st marys church in the hollow of the white hazel, the nearby hamlet of llantysilio gogogoch the church of st tysilio of the red cave, and the chwyrn drobwll rapid whirlpool between them. Straight outta llanfair, longest welsh name shirt, womens fitted tshirt, unisex tank top, hoodie, sweatshirt, funny welsh shirt, funny name. Welcome to the welsh village with the name in britain. Unfortunately we cant list all 3,848 towns onto one page because the load time would be uncomfortale, so the data has been broken down by counties in wales, uk and alphabetically.
Although the title for longest place name in the world belongs to a hill in new zealand with an absurd 85 letters, llanfair pg holds second place and first place in europe with its mouthful of 58 letters. Mar 12, 20 at 85 letters, it has been listed in the guinness world records as the longest place name in the entire world. The beautiful isle of anglesey or ynys mon in welsh was so interesting itself. How to pronounce llanfairpwllgwyn long welsh town duration. Welsh town claims record title for worlds steepest street. Wondering how to say the longest town name in the world. Wales united kingdom small town guiness book of world records. Its capital and main commercial and financial center is cardiff.
The welsh town with a name longer than this headline. The tiny town on the island of anglesey in wales recently made headlines when liam dutton, a uk weatherman, pronounced it during a live report without skipping a beat. Toponymy in wales reveals significant features of the countrys history and geography, as well as the development of the welsh language. While living in the town with the most letters may be a good conversation piece, in 1988 the towns name was shortened to llanfair pwllgwyngll, leaving just 20 letters. Llanfairpwllgwyngyll simple english wikipedia, the free encyclopedia. Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch this is a name for a place in north wales, its the longest name for a place in the world. Bradley walsh tries to pronounce llanfair pg in a question, mark labbett as the chaser. It is in the guinness book of records for being the place with the longest name in. It was the longest place name in an englishspeaking country, but has been challenged by. Jan 23, 2020 a village in anglesey in north wales, known for having the longest place name in the united kingdom. With one of the longest names of any place in the united kingdom the welsh village of llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch is.
Its study is promoted by the welsh place name society. Heres the story behind the 58letter town name in wales that everyone is talking about. Longest city names thailand s capital city is the wellknown and popular tourist destination of bangkok, but most people dont know that bangkoks full ceremonial name is in fact krung thep mahanakhon amon rattanakosin mahinthara yuthaya mahadilok phop noppharat ratchathani burirom udomratchaniwet mahasathan amon piman awatan sathit. Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch this is a name for a place in north wales, its the longest name.
Jan 17, 2009 this is the name of a town in north wales. Tautological place names are systematically generated in languages such as english and russian, where the type of the feature is systematically added to a name regardless of whether it contains it already. Channel 4 weatherman pronounces longest place name in. Worth going there just to get a platform ticket with the name on it. These days, we take our amusement anywhere we can find it, including in the bizarre and sometimes inexplicable history of our surroundings. Wed read about the town with the long name, and so we made a point of stopping by while touring the island of anglesey in wales, just to see it for ourselves. Weatherman totally nails longest place name in the u. The name, which is printed on the villages absurdly long train station sign translates from the welsh as, st. American brothers try to say the longest town name in the.
The longest town name in the world means the church of st. With one of the longest names of any place in the united kingdom the welsh village of llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch is unmistakable. Watch naomi watts pronounce name of waless longest town. Tysilios of the red cave in welsh, has long claimed the fame of having the longest name in the world. Sep, 2015 heres the story behind the 58letter town name in wales that everyone is talking about. Then, patiently, she took a deep breath and recited the correct pronunciation for the longest town name in europe. Heres the story behind the 58letter town name in wales that.
This weatherman nails the pronunciation of the longest welsh town name in existence. British weatherman liam dutton pronounced the 58letter name of welsh village llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch. Borrowed from welsh llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch. The welsh town with a name longer than this headline conde. Listed in the guinness book of records 2002 included in the new anglesey monopoly game see article on the bbc website. The little welsh town thats home to britains best high street. Famed for its rugged landscape, wales retains aspects of celtic culture that are markedly different from those of its english neighbors. Wales, constituent unit of the united kingdom that forms a westward extension of the island of great britain. The city and town name generator uses a database of over five million names across more than 150 countries. Americans pronounce welsh town names insanely difficult. Channel 4 weatherman pronounces longest place name. The name means st marys church in the hollow of the white hazel near to the fierce whirlpool of st tysilio of the red cave in welsh.
The story behind the welsh town has the longest name in europe. If theres one thing welsh place names arent known for, its having a lot of vowels. On the welsh island of anglesey, across the menai strait from the city of bangor, sits. British weatherman liam dutton nailed an incredibly long welsh town name, and its truly something to behold video. April 24 upi a florida police officer called to a residents home on a report of a. Our database currently has a total of 3,848 townsvillages in wales, uk. Weatherman nails 58letter name of welsh town in single try. Well, channel 4s welsh weather presenter liam dutton made the time in a recent forecast. What the longest word in the welsh language answers.
Welsh weatherman correctly pronounces welsh town name. The long form of the name is the longest place name in the united kingdom and one of the longest in the world at 58 characters 51 letters since ch and ll are digraphs, and are treated as single letters in the welsh language literally translated, the name means. Llanfairpwllgwyngyll simple english wikipedia, the free. Its worth keeping in mind that in welsh, w and y are vowels, so the language isnt quite a. A welsh weatherman pronounced one of the longest town names in europe like it was nothing, garnering buzz online. Listed in the 2002 guinness book of records as the worlds longest valid internet domain name. Llanfairpwllgwyngyll or llanfair pwllgwyngyll is a village on the island of anglesey in wales, britain. What is the longest place name in wales and where is this. Theres a church and monument to local hero henry paget, who lost a leg in the battle of waterloo you can even climb to the top. About this video americans pronounce welsh town names insanely difficult longest in the world. This longer form of the name was invented for promotional purposes in the 1860s.
Channel 4 weatherman pronounces 58letter town name on tv. Top ten places to see in wales that should be on your bucket list. We get asked that about 30 times a day, she told me. Sampled from 1976 rereleased in 1979 single the lone ranger by british band. Yes, believe it or not, that is the actual full name of a village we visited during our recent tour of the welsh countryside. Weatherman nails longest welsh town name in weather report video this is going to astound you beyond belief. Marys church in the hollow of the white hazel near the rapid whirlpool of. There is a welsh town whose normal name is llanfairpwllgwyngyll, from the welsh for church of st. Near porangahau in hawkes bay is an unassuming hill known as taumata whakatangi hangakoauau o tamatea turi pukakapiki maunga horo nuku pokai whenua kitanatahu, which translates into english as the place where tamatea, the man with the big knees, who slid, climbed and swallowed mountains, known as landeater, played his flute to his loved one. Marys church in the hollow of white hazel near a rapid whirlpool and the church of. Unlike the english, welsh people are celtic descendants. Jeopardy champ ken jennings explains how the wales town. The collection folktales form wales consists of one book with 24 folktales.
Watch a welsh weatherman casually, correctly pronounce a 58letter town name. British weatherman liam dutton pronounced the 58letter name of welsh village llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch flawlessly. Llanfair pg is home to a visitor center full of classic welsh handicrafts and yummy baked goods. Meteorologist nails this ridiculously long welsh towns. The following is a list of place names often used tautologically, plus the languages from which the nonenglish name elements have come. Mary llanfair of the pool pwll of the white hazels gwyn gyll near lit. Llanfairpwllgwyngyllgogerychwyrndrobwyllllantysiliogogogoch is just one of the welsh town names we a. The village is also known as llanfair pg or llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch. With 51 characters the ch and ll are single letters in the welsh language. The longest official place name in the world, the 85letter. Itv1 the chase bradley tries to pronounce llanfair. If you are looking for a random city or town name to spark a location for a book, game, or a script, millions of possibilities are at your finger tips. The long form of the name is the longest place name in the united kingdom and one of the.
Top 5 places with the longest names history rundown. With one of the longest names of any place in the united kingdom the welsh village of llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch is unmistakable, which is exactly what the people. The place names of wales derive in most cases from the welsh language, but have also been influenced by linguistic contact with the romans, anglosaxons, vikings, anglonormans and modern english. From bwlchgwyn to ysbyty ystwyth, wales is dotted with towns and villages devoid of those little letters the. Llanfairpwllgwyngyll or llanfair pwllgwyngyll is a large village and local government community on the island of anglesey in wales. Though its officially shortened, that doesnt stop some from using the towns full name. Llanfairpwllgwyngyllgogerychwyrndrobwyllllantysiliogogogoch is just one of the welsh town names we attempt. According to travel writer dave fox, the longest town name in europe is welsh for st.
668 362 756 1278 407 986 1077 643 955 683 1472 164 506 993 992 842 977 1042 227 880 568 354 1346 650 186 1327 1309 517 1182 607 926 1425 1410 1044 987 407 647 975 1050 1014 213 392 442 611 844 727